HIST2H2BF antibody (N-Term)

Catalog No. ABIN630669

Product Details anti-HIST2H2BF Antibody

Target: HIST2H2BF (Histone H2B Type 2-F (HIST2H2BF))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HIST2H2BF antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HIST2 H2 F antibody was raised against the N terminal of HIST2 2 F

Purification: Affinity purified

Immunogen: HIST2 H2 F antibody was raised using the N terminal of HIST2 2 F corresponding to a region with amino acids MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HIST2H2BF Blocking Peptide, catalog no. 33R-6272, is also available for use as a blocking control in assays to test for specificity of this HIST2H2BF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIST0 0 F antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HIST2H2BF

Target: HIST2H2BF (Histone H2B Type 2-F (HIST2H2BF))

Alternative Name: HIST2H2BF (HIST2H2BF Products)

Synonyms: histone cluster 2, H2bf antibody, histone cluster 2 H2B family member f antibody, HIST2H2BF antibody

Background: HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Molecular Weight: 14 kDa (MW of target protein)