ERCC4 antibody (Middle Region)
-
- Target See all ERCC4 Antibodies
- ERCC4 (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 4 (ERCC4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ERCC4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ERCC4 antibody was raised against the middle region of Ercc4
- Purification
- Affinity purified
- Immunogen
- ERCC4 antibody was raised using the middle region of Ercc4 corresponding to a region with amino acids FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST
- Top Product
- Discover our top product ERCC4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ERCC4 Blocking Peptide, catalog no. 33R-2974, is also available for use as a blocking control in assays to test for specificity of this ERCC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERCC4 (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 4 (ERCC4))
- Alternative Name
- ERCC4 (ERCC4 Products)
- Synonyms
- ERCC11 antibody, FANCQ antibody, RAD1 antibody, XPF antibody, AI606920 antibody, Xpf antibody, RGD1560340 antibody, fi03a05 antibody, zgc:63468 antibody, wu:fi03a05 antibody, ercc11 antibody, rad1 antibody, xpf antibody, ERCC4 antibody, LOC100231158 antibody, ERCC excision repair 4, endonuclease catalytic subunit antibody, excision repair cross-complementing rodent repair deficiency, complementation group 4 antibody, excision repair cross-complementation group 4 antibody, excision repair cross-complementation group 4 L homeolog antibody, ERCC4 antibody, Ercc4 antibody, ercc4 antibody, ercc4.L antibody, XPF antibody
- Background
- The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1.
- Molecular Weight
- 101 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-