NUDT17 antibody

Catalog No. ABIN630706

Product Details anti-NUDT17 Antibody

Target: NUDT17 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 17 (NUDT17))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUDT17 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NUDT17 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUDT17 Blocking Peptide, catalog no. 33R-10206, is also available for use as a blocking control in assays to test for specificity of this NUDT17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUDT17

Target: NUDT17 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 17 (NUDT17))

Alternative Name: NUDT17 (NUDT17 Products)

Synonyms: 2410015C20Rik antibody, RGD1565469 antibody, zgc:114128 antibody, nudix hydrolase 17 antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 17 antibody, NUDT17 antibody, Nudt17 antibody, nudt17 antibody

Background: NUDT17 belongs to the Nudix hydrolase family. It probably mediates the hydrolysis of some nucleoside diphosphate derivatives.

Molecular Weight: 36 kDa (MW of target protein)