IMPDH2 antibody

Catalog No. ABIN630710

Product Details anti-IMPDH2 Antibody

Target: IMPDH2 (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IMPDH2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: IMPDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IMPDH2 Blocking Peptide, catalog no. 33R-8336, is also available for use as a blocking control in assays to test for specificity of this IMPDH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IMPDH2

Target: IMPDH2 (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2))

Alternative Name: IMPDH2 (IMPDH2 Products)

Synonyms: imp2 antibody, impd2 antibody, impdh-ii antibody, impdh2 antibody, IMPD2 antibody, IMPDH-II antibody, IMPD 2 antibody, IMPDH 2 antibody, cb635 antibody, wu:fb64g02 antibody, wu:fc43f09 antibody, IMPD antibody, inosine monophosphate dehydrogenase 2 antibody, IMP (inosine 5'-monophosphate) dehydrogenase 2 antibody, inosine 5'-phosphate dehydrogenase 2 antibody, IMPDH2 antibody, impdh2.S antibody, impdh2 antibody, Impdh2 antibody

Background: IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interactome