IVNS1ABP antibody (N-Term)

Catalog No. ABIN630725

Product Details anti-IVNS1ABP Antibody

Target: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Binding Specificity: N-Term

Reactivity: Influenza A Virus

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IVNS1ABP antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Influenza Virus Ns1 A Binding Protein antibody was raised against the N terminal of IVNS1 BP

Cross-Reactivity: Human, Dog (Canine)

Purification: Affinity purified

Immunogen: Influenza Virus Ns1 A Binding Protein antibody was raised using the N terminal of IVNS1 BP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Influenza Virus Ns1A Binding Protein Blocking Peptide, catalog no. 33R-7827, is also available for use as a blocking control in assays to test for specificity of this Influenza Virus Ns1A Binding Protein antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IVNS0 BP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IVNS1ABP

Target: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Alternative Name: Influenza Virus Ns1A Binding Protein (IVNS1ABP Products)

Synonyms: 1190004M08Rik antibody, 1700126I16Rik antibody, AA960440 antibody, HSPC068 antibody, ND1 antibody, NS-1 antibody, NS1-BP antibody, Nd1-L antibody, Nd1-S antibody, mKIAA0850 antibody, cb1052 antibody, fj23g11 antibody, ivns1abp antibody, wu:fj23g11 antibody, FLARA3 antibody, KLHL39 antibody, NS1BP antibody, fi13f08 antibody, fi41c09 antibody, wu:fi13f08 antibody, wu:fi41c09 antibody, influenza virus NS1A binding protein antibody, influenza virus NS1A binding protein a antibody, influenza virus NS1A binding protein L homeolog antibody, influenza virus NS1A binding protein b antibody, Ivns1abp antibody, ivns1abpa antibody, ivns1abp.L antibody, IVNS1ABP antibody, ivns1abpb antibody

Target Type: Influenza Protein

Background: This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.

Molecular Weight: 72 kDa (MW of target protein)

Pathways: Negative Regulation of intrinsic apoptotic Signaling