NUSAP1 antibody (Middle Region)

Catalog No. ABIN630728

Product Details anti-NUSAP1 Antibody

Target: NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUSAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NUSAP1 antibody was raised against the middle region of NUSAP1

Purification: Affinity purified

Immunogen: NUSAP1 antibody was raised using the middle region of NUSAP1 corresponding to a region with amino acids AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUSAP1 Blocking Peptide, catalog no. 33R-1139, is also available for use as a blocking control in assays to test for specificity of this NUSAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUSAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUSAP1

Target: NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))

Alternative Name: NUSAP1 (NUSAP1 Products)

Synonyms: ANKT antibody, BM037 antibody, LNP antibody, NUSAP antibody, PRO0310p1 antibody, Q0310 antibody, SAPL antibody, 2610201A12Rik antibody, AI481307 antibody, AW547774 antibody, BB165529 antibody, NuSAP antibody, YF-9 antibody, ankt antibody, fb76a01 antibody, fi37a11 antibody, sb:cb490 antibody, wu:fb76a01 antibody, wu:fi37a11 antibody, lnp antibody, nusap antibody, nusap1 antibody, sapl antibody, nucleolar and spindle associated protein 1 antibody, nucleolar and spindle associated protein 1 L homeolog antibody, nucleolar and spindle associated protein 1 S homeolog antibody, NUSAP1 antibody, Nusap1 antibody, nusap1 antibody, nusap1.L antibody, nusap1.S antibody

Background: NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.

Molecular Weight: 49 kDa (MW of target protein)