GSTT1 antibody (C-Term)
-
- Target See all GSTT1 Antibodies
- GSTT1 (Glutathione S-Transferase theta 1 (GSTT1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GSTT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GSTT1 antibody was raised against the C terminal of GSTT1
- Purification
- Affinity purified
- Immunogen
- GSTT1 antibody was raised using the C terminal of GSTT1 corresponding to a region with amino acids TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
- Top Product
- Discover our top product GSTT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GSTT1 Blocking Peptide, catalog no. 33R-9381, is also available for use as a blocking control in assays to test for specificity of this GSTT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTT1 (Glutathione S-Transferase theta 1 (GSTT1))
- Alternative Name
- GSTT1 (GSTT1 Products)
- Synonyms
- GSTT1 antibody, LOC100285763 antibody, cb870 antibody, gstt1 antibody, AI255817 antibody, Gstt1-1 antibody, GSTYRS antibody, zgc:65964 antibody, glutathione S-transferase theta 1 antibody, glutathione S-transferase theta-4 antibody, glutathione S-transferase theta-1 antibody, glutathione S-transferase theta 1a antibody, glutathione S-transferase, theta 1 antibody, glutathione S-transferase theta 1 L homeolog antibody, glutathione S-transferase theta 1b antibody, GSTT1 antibody, LOC700446 antibody, LOC100285763 antibody, gstt1a antibody, Gstt1 antibody, LOC477556 antibody, LOC100153094 antibody, LOC100338194 antibody, gstt1.L antibody, gstt1b antibody
- Background
- Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis.
- Molecular Weight
- 27 kDa (MW of target protein)
-