GLT6D1 antibody (Middle Region)

Catalog No. ABIN630779

Product Details anti-GLT6D1 Antibody

Target: GLT6D1 (Glycosyltransferase 6 Domain Containing 1 (GLT6D1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLT6D1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLT6 D1 antibody was raised against the middle region of GLT6 1

Purification: Affinity purified

Immunogen: GLT6 D1 antibody was raised using the middle region of GLT6 1 corresponding to a region with amino acids FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLT6D1 Blocking Peptide, catalog no. 33R-2916, is also available for use as a blocking control in assays to test for specificity of this GLT6D1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLT6D1

Target: GLT6D1 (Glycosyltransferase 6 Domain Containing 1 (GLT6D1))

Alternative Name: GLT6D1 (GLT6D1 Products)

Synonyms: GLTDC1 antibody, GT6M7 antibody, GT6m7 antibody, Gltdc1 antibody, 4933411C14Rik antibody, QtsA-20904 antibody, glycosyltransferase 6 domain containing 1 antibody, GLT6D1 antibody, Glt6d1 antibody

Background: GLT6D1 is a single-pass type II membrane protein. It belongs to the glycosyltransferase 6 family. The exact function of GLT6D1 remains unknown.

Molecular Weight: 32 kDa (MW of target protein)