URGCP antibody (Middle Region)
-
- Target See all URGCP Antibodies
- URGCP (Upregulator of Cell Proliferation (URGCP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This URGCP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- URG4 antibody was raised against the middle region of URG4
- Purification
- Affinity purified
- Immunogen
- URG4 antibody was raised using the middle region of URG4 corresponding to a region with amino acids AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR
- Top Product
- Discover our top product URGCP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
URG4 Blocking Peptide, catalog no. 33R-1272, is also available for use as a blocking control in assays to test for specificity of this URG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of URG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- URGCP (Upregulator of Cell Proliferation (URGCP))
- Alternative Name
- URG4 (URGCP Products)
- Background
- URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival.
- Molecular Weight
- 100 kDa (MW of target protein)
-