URGCP antibody (Middle Region)

Catalog No. ABIN630797

Product Details anti-URGCP Antibody

Target: URGCP (Upregulator of Cell Proliferation (URGCP))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This URGCP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: URG4 antibody was raised against the middle region of URG4

Purification: Affinity purified

Immunogen: URG4 antibody was raised using the middle region of URG4 corresponding to a region with amino acids AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

URG4 Blocking Peptide, catalog no. 33R-1272, is also available for use as a blocking control in assays to test for specificity of this URG4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of URG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for URGCP

Target: URGCP (Upregulator of Cell Proliferation (URGCP))

Alternative Name: URG4 (URGCP Products)

Background: URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival.

Molecular Weight: 100 kDa (MW of target protein)