HSPH1 antibody (Middle Region)

Catalog No. ABIN630808

Product Details anti-HSPH1 Antibody

Target: HSPH1 (Heat Shock 105kDa/110kDa Protein 1 (HSPH1))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPH1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HSPH1 antibody was raised against the middle region of HSPH1

Purification: Affinity purified

Immunogen: HSPH1 antibody was raised using the middle region of HSPH1 corresponding to a region with amino acids EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPH1 Blocking Peptide, catalog no. 33R-2377, is also available for use as a blocking control in assays to test for specificity of this HSPH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPH1

Target: HSPH1 (Heat Shock 105kDa/110kDa Protein 1 (HSPH1))

Alternative Name: HSPH1 (HSPH1 Products)

Synonyms: hsp105 antibody, hsp105a antibody, hsp105b antibody, hsp110 antibody, hsph1b antibody, Hsp105 antibody, HSP105 antibody, HSP105A antibody, HSP105B antibody, NY-CO-25 antibody, 105kDa antibody, AI790491 antibody, Hsp110 antibody, hsp-E7I antibody, hsph1 antibody, hsph1a antibody, heat shock protein family H (Hsp110) member 1 antibody, heat shock protein family H (Hsp110) member 1 S homeolog antibody, heat shock protein 105 kDa antibody, heat shock 105kDa/110kDa protein 1 antibody, heat shock protein family H (Hsp110) member 1 L homeolog antibody, hsph1 antibody, hsph1.S antibody, HSPH1 antibody, LOC100546590 antibody, Hsph1 antibody, hsph1.L antibody

Background: HSPH1 prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. It inhibits HSPA8/HSC70 ATPase and chaperone activities.

Molecular Weight: 97 kDa (MW of target protein)