LGALS8 antibody

Catalog No. ABIN630814

Product Details anti-LGALS8 Antibody

Target: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LGALS8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LGALS8 Blocking Peptide, catalog no. 33R-3014, is also available for use as a blocking control in assays to test for specificity of this LGALS8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LGALS8

Target: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Alternative Name: LGALS8 (LGALS8 Products)

Synonyms: LGALS8 antibody, 1200015E08Rik antibody, AI326142 antibody, D13Ertd524e antibody, Lgals-8 antibody, galectin-8 antibody, Gal-8 antibody, PCTA-1 antibody, PCTA1 antibody, Po66-CBP antibody, xgalectin-VIIIa antibody, galectin 8 antibody, lectin, galactose binding, soluble 8 antibody, lectin, galactoside binding soluble 8 S homeolog antibody, LGALS8 antibody, Lgals8 antibody, lgals8.S antibody

Background: LGALS8 is a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.

Molecular Weight: 39 kDa (MW of target protein)