Peroxiredoxin 1 antibody (N-Term)

Catalog No. ABIN630826

Product Details anti-Peroxiredoxin 1 Antibody

Target: Peroxiredoxin 1 (PRDX1)

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peroxiredoxin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRDX1 antibody was raised against the N terminal of PRDX1

Purification: Affinity purified

Immunogen: PRDX1 antibody was raised using the N terminal of PRDX1 corresponding to a region with amino acids SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRDX1 Blocking Peptide, catalog no. 33R-8807, is also available for use as a blocking control in assays to test for specificity of this PRDX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peroxiredoxin 1

Target: Peroxiredoxin 1 (PRDX1)

Alternative Name: PRDX1 (PRDX1 Products)

Synonyms: MSP23 antibody, NKEF-A antibody, NKEFA antibody, PAG antibody, PAGA antibody, PAGB antibody, PRX1 antibody, PRXI antibody, TDPX2 antibody, NkefA antibody, OSF-3 antibody, OSF3 antibody, Paga antibody, PrdxI antibody, PrxI antibody, TDX2 antibody, TPxA antibody, Tdpx2 antibody, prx1 antibody, Hbp23 antibody, MGC80194 antibody, MGC84820 antibody, PRDX1 antibody, msp23 antibody, nkefa antibody, pag antibody, paga antibody, pagb antibody, prx-1 antibody, prxi antibody, tdpx2 antibody, hm:zehl0637 antibody, zgc:110343 antibody, TPX-2 antibody, peroxiredoxin 1 antibody, peroxiredoxin 1 S homeolog antibody, peroxiredoxin-1 pseudogene antibody, PRDX1 antibody, Prdx1 antibody, prdx1.S antibody, prdx1 antibody, LOC100350232 antibody

Background: PRDX1 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: p53 Signaling, EGFR Signaling Pathway, CXCR4-mediated Signaling Events