PNPLA8 antibody (Middle Region)

Catalog No. ABIN630834

Product Details anti-PNPLA8 Antibody

Target: PNPLA8 (Patatin-Like phospholipase Domain Containing 8 (PNPLA8))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNPLA8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PNPLA8 antibody was raised against the middle region of PNPLA8

Purification: Affinity purified

Immunogen: PNPLA8 antibody was raised using the middle region of PNPLA8 corresponding to a region with amino acids IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNPLA8 Blocking Peptide, catalog no. 33R-3926, is also available for use as a blocking control in assays to test for specificity of this PNPLA8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNPLA8

Target: PNPLA8 (Patatin-Like phospholipase Domain Containing 8 (PNPLA8))

Alternative Name: PNPLA8 (PNPLA8 Products)

Synonyms: IPLA2(GAMMA) antibody, IPLA2-2 antibody, IPLA2G antibody, iPLA2gamma antibody, 1200006O19Rik antibody, AI467579 antibody, Ipla2(gamma) antibody, RGD1311444 antibody, iPLA2 antibody, patatin like phospholipase domain containing 8 antibody, patatin-like phospholipase domain containing 8 antibody, PNPLA8 antibody, Pnpla8 antibody

Background: Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors.

Molecular Weight: 88 kDa (MW of target protein)