Peroxiredoxin 2 antibody (Middle Region)

Catalog No. ABIN630843

Product Details anti-Peroxiredoxin 2 Antibody

Target: Peroxiredoxin 2 (PRDX2)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peroxiredoxin 2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRDX2 antibody was raised against the middle region of PRDX2

Purification: Affinity purified

Immunogen: PRDX2 antibody was raised using the middle region of PRDX2 corresponding to a region with amino acids VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRDX2 Blocking Peptide, catalog no. 33R-9664, is also available for use as a blocking control in assays to test for specificity of this PRDX2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peroxiredoxin 2

Target: Peroxiredoxin 2 (PRDX2)

Alternative Name: PRDX2 (PRDX2 Products)

Synonyms: NKEF-B antibody, NKEFB antibody, PRP antibody, PRX2 antibody, PRXII antibody, PTX1 antibody, TDPX1 antibody, TPX1 antibody, TSA antibody, AL022839 antibody, Band-8 antibody, NkefB antibody, PrxII antibody, TDX1 antibody, TPx antibody, TPx-B antibody, TR antibody, Tdpx1 antibody, Torin antibody, nkefb antibody, prx-2 antibody, prx2 antibody, prxii antibody, tdpx1 antibody, tpx1 antibody, peroxiredoxin 2 antibody, peroxiredoxin 2 L homeolog antibody, PRDX2 antibody, Prdx2 antibody, prdx2.L antibody

Background: PRDX2 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms.

Molecular Weight: 22 kDa (MW of target protein)