PIWIL4 antibody

Catalog No. ABIN630849

Product Details anti-PIWIL4 Antibody

Target: PIWIL4 (Piwi-Like 4 (PIWIL4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIWIL4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIWIL4 Blocking Peptide, catalog no. 33R-8482, is also available for use as a blocking control in assays to test for specificity of this PIWIL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIWIL4

Target: PIWIL4 (Piwi-Like 4 (PIWIL4))

Alternative Name: PIWIL4 (PIWIL4 Products)

Synonyms: HIWI2 antibody, MIWI2 antibody, 9230101H05Rik antibody, Miwi2 antibody, piwi like RNA-mediated gene silencing 4 antibody, piwi-like RNA-mediated gene silencing 4 antibody, PIWIL4 antibody, Piwil4 antibody

Background: PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

Molecular Weight: 96 kDa (MW of target protein)