PIWIL2 antibody

Catalog No. ABIN630850

Product Details anti-PIWIL2 Antibody

Target: PIWIL2 (Piwi-Like 2 (PIWIL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIWIL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PIWIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIWIL2 Blocking Peptide, catalog no. 33R-7778, is also available for use as a blocking control in assays to test for specificity of this PIWIL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIWIL2

Target: PIWIL2 (Piwi-Like 2 (PIWIL2))

Alternative Name: PIWIL2 (PIWIL2 Products)

Synonyms: si:dkey-88f5.1 antibody, zili antibody, Piwil1l antibody, mili antibody, CT80 antibody, HILI antibody, PIWIL1L antibody, piwil2 antibody, piwi like RNA-mediated gene silencing 2 antibody, piwi-like RNA-mediated gene silencing 2 antibody, piwil2 antibody, Piwil2 antibody, PIWIL2 antibody

Background: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

Molecular Weight: 110 kDa (MW of target protein)

Pathways: Stem Cell Maintenance