SPNS2 antibody

Catalog No. ABIN630851

Product Details anti-SPNS2 Antibody

Target: SPNS2 (Spinster Homolog 2 (SPNS2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPNS2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPNS2 Blocking Peptide, catalog no. 33R-7255, is also available for use as a blocking control in assays to test for specificity of this SPNS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPNS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPNS2

Target: SPNS2 (Spinster Homolog 2 (SPNS2))

Alternative Name: SPNS2 (SPNS2 Products)

Synonyms: fi20h04 antibody, si:dkey-7b17.4 antibody, toh antibody, wu:fi20h04 antibody, DKFZp459J1933 antibody, spinster homolog 2 (Drosophila) antibody, sphingolipid transporter 2 antibody, spinster homolog 2 antibody, SPNS2 antibody, spns2 antibody, Spns2 antibody

Background: SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.

Molecular Weight: 60 kDa (MW of target protein)