FANCE antibody (Middle Region)
-
- Target See all FANCE Antibodies
- FANCE (Fanconi Anemia, Complementation Group E (FANCE))
-
Binding Specificity
- AA 1-13, Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FANCE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FANCE antibody was raised against the middle region of FANCE
- Purification
- Affinity purified
- Immunogen
- FANCE antibody was raised using the middle region of FANCE corresponding to a region with amino acids SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH
- Top Product
- Discover our top product FANCE Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FANCE Blocking Peptide, catalog no. 33R-8689, is also available for use as a blocking control in assays to test for specificity of this FANCE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FANCE (Fanconi Anemia, Complementation Group E (FANCE))
- Alternative Name
- FANCE (FANCE Products)
- Synonyms
- FANCE antibody, fae antibody, face antibody, FACE antibody, FAE antibody, 2810451D06Rik antibody, AI415634 antibody, AW209126 antibody, RGD1561045 antibody, Fanconi anemia complementation group E antibody, Fanconi anemia, complementation group E antibody, FANCE antibody, fance antibody, Fance antibody
- Background
- The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-