PPIL2 antibody

Catalog No. ABIN630873

Product Details anti-PPIL2 Antibody

Target: PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPIL2 Blocking Peptide, catalog no. 33R-3545, is also available for use as a blocking control in assays to test for specificity of this PPIL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPIL2

Target: PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))

Alternative Name: PPIL2 (PPIL2 Products)

Synonyms: cyc4 antibody, cyp60 antibody, hcyp-60 antibody, CYC4 antibody, CYP60 antibody, Cyp-60 antibody, UBOX7 antibody, hCyP-60 antibody, 0610009L05Rik antibody, 1700016N17Rik antibody, 4921520K19Rik antibody, 4930511F14Rik antibody, AA589416 antibody, C130078A06Rik antibody, si:dkeyp-86g2.1 antibody, zgc:56616 antibody, zgc:86735 antibody, peptidylprolyl isomerase like 2 S homeolog antibody, peptidylprolyl isomerase like 2 antibody, peptidylprolyl isomerase (cyclophilin)-like 2 antibody, ppil2.S antibody, PPIL2 antibody, ppil2 antibody, Ppil2 antibody

Background: PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.

Molecular Weight: 59 kDa (MW of target protein)