ADAMTS4 antibody (N-Term)

Catalog No. ABIN630877

Product Details anti-ADAMTS4 Antibody

Target: ADAMTS4 (ADAM Metallopeptidase with Thrombospondin Type 1 Motif, 4 (ADAMTS4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAMTS4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ADAMTS4 antibody was raised against the N terminal of ADAMTS4

Purification: Affinity purified

Immunogen: ADAMTS4 antibody was raised using the N terminal of ADAMTS4 corresponding to a region with amino acids GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAMTS4 Blocking Peptide, catalog no. 33R-3654, is also available for use as a blocking control in assays to test for specificity of this ADAMTS4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMTS4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAMTS4

Target: ADAMTS4 (ADAM Metallopeptidase with Thrombospondin Type 1 Motif, 4 (ADAMTS4))

Alternative Name: ADAMTS4 (ADAMTS4 Products)

Synonyms: 3830423K05 antibody, ADAM-TS4 antibody, ADAMTS-2 antibody, ADMP-1 antibody, mKIAA0688 antibody, ADAMTS-4 antibody, ADAMTS4 antibody, a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 4 antibody, ADAM metallopeptidase with thrombospondin type 1 motif 4 antibody, ADAM metallopeptidase with thrombospondin type 1 motif, 4 antibody, Adamts4 antibody, ADAMTS4 antibody

Background: ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS4 lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.

Molecular Weight: 37 kDa (MW of target protein)