XRCC4 antibody (Middle Region)

Catalog No. ABIN630879

Product Details anti-XRCC4 Antibody

Target: XRCC4 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XRCC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: XRCC4 antibody was raised against the middle region of XRCC4

Purification: Affinity purified

Immunogen: XRCC4 antibody was raised using the middle region of XRCC4 corresponding to a region with amino acids LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XRCC4 Blocking Peptide, catalog no. 33R-5319, is also available for use as a blocking control in assays to test for specificity of this XRCC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XRCC4

Target: XRCC4 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4))

Alternative Name: XRCC4 (XRCC4 Products)

Synonyms: zgc:73312 antibody, MGC81443 antibody, homolog of human DNA ligase iv-binding protein XRCC4 antibody, 2310057B22Rik antibody, AW413319 antibody, AW545101 antibody, X-ray repair cross complementing 4 antibody, X-ray repair complementing defective repair in Chinese hamster cells 4 antibody, X-ray repair complementing defective repair in Chinese hamster cells 4 L homeolog antibody, DNA ligase IV-binding protein antibody, XRCC4 antibody, xrcc4 antibody, xrcc4.L antibody, Xrcc4 antibody

Background: XRCC4 functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: DNA Damage Repair, Production of Molecular Mediator of Immune Response