PSMA3 antibody

Catalog No. ABIN630882

Product Details anti-PSMA3 Antibody

Target: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMA3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMA3 Blocking Peptide, catalog no. 33R-9616, is also available for use as a blocking control in assays to test for specificity of this PSMA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMA3

Target: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Alternative Name: PSMA3 (PSMA3 Products)

Synonyms: HC8 antibody, PSC3 antibody, Psma3l antibody, psma3 antibody, im:6909944 antibody, zgc:114044 antibody, Lmpc8 antibody, proteasome subunit alpha 3 antibody, proteasome subunit alpha 3 L homeolog antibody, proteasome (prosome, macropain) subunit, alpha type 3 antibody, PSMA3 antibody, Psma3 antibody, psma3.L antibody, psma3 antibody

Background: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA