PPP2R3A antibody

Catalog No. ABIN630911

Product Details anti-PPP2R3A Antibody

Target: PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP2R3A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP2R3A Blocking Peptide, catalog no. 33R-8853, is also available for use as a blocking control in assays to test for specificity of this PPP2R3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP2R3A

Target: PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))

Alternative Name: PPP2R3A (PPP2R3A Products)

Synonyms: PPP2R3 antibody, PR130 antibody, PR72 antibody, 3222402P14Rik antibody, A730042E07 antibody, PPP2R3A antibody, Ppp2r3a antibody, protein phosphatase 2 regulatory subunit B''alpha antibody, protein phosphatase 2, regulatory subunit B'', alpha antibody, protein phosphatase 2 regulatory subunit B, alpha S homeolog antibody, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha antibody, PPP2R3A antibody, Ppp2r3a antibody, ppp2r3a.S antibody, LOC100088744 antibody, LOC100478108 antibody, ppp2r3a antibody, LOC100547843 antibody, LOC100729010 antibody

Background: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division.

Molecular Weight: 130 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling