PSMB4 antibody

Catalog No. ABIN630916

Product Details anti-PSMB4 Antibody

Target: PSMB4 (Proteasome (Prosome, Macropain) Subunit, beta Type, 4 (PSMB4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMB4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMB4 Blocking Peptide, catalog no. 33R-8775, is also available for use as a blocking control in assays to test for specificity of this PSMB4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMB4

Target: PSMB4 (Proteasome (Prosome, Macropain) Subunit, beta Type, 4 (PSMB4))

Alternative Name: PSMB4 (PSMB4 Products)

Synonyms: An18g06680 antibody, PSMB4 antibody, Pros-27 antibody, HN3 antibody, HsN3 antibody, PROS-26 antibody, PROS26 antibody, im:6909492 antibody, zgc:110330 antibody, proteasome subunit beta type-4 antibody, proteasome subunit beta 4 antibody, proteasome (prosome, macropain) subunit, beta type 4 antibody, proteasome subunit beta 4 L homeolog antibody, ANI_1_890164 antibody, PSMB4 antibody, psmb4 antibody, Psmb4 antibody, psmb4.L antibody

Background: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB4 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA