PSMB2 antibody
-
- Target See all PSMB2 Antibodies
- PSMB2 (Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD
- Top Product
- Discover our top product PSMB2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMB2 Blocking Peptide, catalog no. 33R-4864, is also available for use as a blocking control in assays to test for specificity of this PSMB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMB2 (Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2))
- Alternative Name
- PSMB2 (PSMB2 Products)
- Synonyms
- HC7-I antibody, 19.m02268 antibody, DDBDRAFT_0190287 antibody, DDBDRAFT_0232958 antibody, DDB_0190287 antibody, DDB_0232958 antibody, Psmb2 antibody, ACYPI004276 antibody, AU045357 antibody, AW108089 antibody, C7-I antibody, D4Wsu33e antibody, zgc:92282 antibody, proteasome subunit beta 2 antibody, proteasome subunit beta type 2 antibody, proteasome beta 2 subunit antibody, putative proteasome beta 2 subunit antibody, 20S proteasome subunit beta-2 antibody, proteasome (prosome, macropain) subunit, beta type 2 antibody, proteasome subunit beta 2 L homeolog antibody, PSMB2 antibody, CNC04990 antibody, Tc00.1047053510287.30 antibody, Tc00.1047053503891.100 antibody, Tc00.1047053508461.430 antibody, LBRM_34_3820 antibody, LBRM_35_0400 antibody, BBOV_I004450 antibody, LMJF_36_0320 antibody, psmB2 antibody, Psmb2 antibody, psmb2 antibody, psmb2.L antibody
- Background
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB2 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.
- Molecular Weight
- 23 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-