PSMB3 antibody

Catalog No. ABIN630921

Product Details anti-PSMB3 Antibody

Target: PSMB3 (Proteasome Subunit beta 3 (PSMB3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMB3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PSMB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMB3 Blocking Peptide, catalog no. 33R-5230, is also available for use as a blocking control in assays to test for specificity of this PSMB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMB3

Target: PSMB3 (Proteasome Subunit beta 3 (PSMB3))

Alternative Name: PSMB3 (PSMB3 Products)

Synonyms: HC10-II antibody, AL033320 antibody, C10-II antibody, PSB3 antibody, psmb3 antibody, wu:fb11d10 antibody, wu:fu88b08 antibody, zgc:56374 antibody, DDBDRAFT_0190542 antibody, DDBDRAFT_0232932 antibody, DDB_0190542 antibody, DDB_0232932 antibody, proteasome subunit beta 3 antibody, proteasome (prosome, macropain) subunit, beta type 3 antibody, proteasome subunit C10-11 antibody, proteasome subunit beta type-3 antibody, proteasome subunit beta 3 S homeolog antibody, 20S proteasome subunit beta-3 antibody, PSMB3 antibody, Psmb3 antibody, LOC100135869 antibody, LOC399377 antibody, psmb3.S antibody, psmb3 antibody, psmB3 antibody

Background: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Cell RedoxHomeostasis, Lipid Metabolism