ATP6V0D2 antibody (Middle Region)
-
- Target See all ATP6V0D2 Antibodies
- ATP6V0D2 (ATPase, H+ Transporting, Lysosomal 38kDa, V0 Subunit D2 (ATP6V0D2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP6V0D2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP6 V6 2 antibody was raised against the middle region of ATP6 6 2
- Purification
- Affinity purified
- Immunogen
- ATP6 V6 2 antibody was raised using the middle region of ATP6 6 2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
- Top Product
- Discover our top product ATP6V0D2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP6V0D2 Blocking Peptide, catalog no. 33R-3417, is also available for use as a blocking control in assays to test for specificity of this ATP6V0D2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP6V0D2 (ATPase, H+ Transporting, Lysosomal 38kDa, V0 Subunit D2 (ATP6V0D2))
- Alternative Name
- ATP6V0D2 (ATP6V0D2 Products)
- Synonyms
- ATP6D2 antibody, VMA6 antibody, AI324824 antibody, V-ATPase antibody, 1620401A02Rik antibody, ATPase H+ transporting V0 subunit d2 antibody, ATPase, H+ transporting, lysosomal V0 subunit D2 antibody, ATPase H+ transporting V0 subunit D2 antibody, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 L homeolog antibody, ATP6V0D2 antibody, Atp6v0d2 antibody, atp6v0d2.L antibody
- Background
- ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Proton Transport
-