KIR2DL4/CD158d antibody (Middle Region)
-
- Target See all KIR2DL4/CD158d (KIR2DL4) Antibodies
- KIR2DL4/CD158d (KIR2DL4) (Killer Cell Immunoglobulin-Like Receptor, Two Domains, Long Cytoplasmic Tail, 4 (KIR2DL4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIR2DL4/CD158d antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIR2 DL4 antibody was raised against the middle region of KIR2 L4
- Purification
- Affinity purified
- Immunogen
- KIR2 DL4 antibody was raised using the middle region of KIR2 L4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR
- Top Product
- Discover our top product KIR2DL4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIR2DL4 Blocking Peptide, catalog no. 33R-9831, is also available for use as a blocking control in assays to test for specificity of this KIR2DL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIR0 L4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIR2DL4/CD158d (KIR2DL4) (Killer Cell Immunoglobulin-Like Receptor, Two Domains, Long Cytoplasmic Tail, 4 (KIR2DL4))
- Alternative Name
- KIR2DL4 (KIR2DL4 Products)
- Synonyms
- G9P antibody, CD158D antibody, KIR103 antibody, KIR103AS antibody, KIR2DL4 antibody, killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4 antibody, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 antibody, KIR2DL4 antibody
- Background
- Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells.
- Molecular Weight
- 30 kDa (MW of target protein)
-