NAT15 antibody

Catalog No. ABIN630953

Product Details anti-NAT15 Antibody

Target: NAT15 (N-Acetyltransferase 15 (NAT15))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAT15 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NAT15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NAT15 Blocking Peptide, catalog no. 33R-2239, is also available for use as a blocking control in assays to test for specificity of this NAT15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAT15

Target: NAT15 (N-Acetyltransferase 15 (NAT15))

Alternative Name: NAT15 (NAT15 Products)

Synonyms: nat15 antibody, im:7141641 antibody, naa60 antibody, zgc:163109 antibody, HAT4 antibody, NAT15 antibody, 1200013P24Rik antibody, AI315146 antibody, Nat15 antibody, RGD1308915 antibody, N(alpha)-acetyltransferase 60, NatF catalytic subunit antibody, N-acetyltransferase 15 (GCN5-related, putative) antibody, naa60 antibody, nat15 antibody, NAA60 antibody, Naa60 antibody

Background: NAT15 most likely functions as an N-acetyltransferase.

Molecular Weight: 27 kDa (MW of target protein)