PTGDS antibody (N-Term)
-
- Target See all PTGDS Antibodies
- PTGDS (Prostaglandin D2 Synthase (PTGDS))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTGDS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PGDS antibody was raised against the N terminal of PGDS
- Purification
- Affinity purified
- Immunogen
- PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKI
- Top Product
- Discover our top product PTGDS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PGDS Blocking Peptide, catalog no. 33R-7239, is also available for use as a blocking control in assays to test for specificity of this PGDS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGDS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTGDS (Prostaglandin D2 Synthase (PTGDS))
- Alternative Name
- PGDS (PTGDS Products)
- Background
- PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.
- Molecular Weight
- 23 kDa (MW of target protein)
-