NIT2 antibody (Middle Region)

Catalog No. ABIN630973

Product Details anti-NIT2 Antibody

Target: NIT2 (Nitrilase Family, Member 2 (NIT2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NIT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NIT2 antibody was raised against the middle region of NIT2

Purification: Affinity purified

Immunogen: NIT2 antibody was raised using the middle region of NIT2 corresponding to a region with amino acids VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NIT2 Blocking Peptide, catalog no. 33R-9421, is also available for use as a blocking control in assays to test for specificity of this NIT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NIT2

Target: NIT2 (Nitrilase Family, Member 2 (NIT2))

Alternative Name: NIT2 (NIT2 Products)

Synonyms: nit2a antibody, 1190017B19Rik antibody, D16Ertd502e antibody, RGD1310494 antibody, zgc:109720 antibody, nitrilase family member 2 S homeolog antibody, nitrilase family member 2 antibody, nitrilase family, member 2 antibody, nit2.S antibody, NIT2 antibody, nit2 antibody, Nit2 antibody

Background: NIT2 belongs to the UPF0012 family and contains 1 CN hydrolase domain. Overexpression of NIT2 decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.

Molecular Weight: 30 kDa (MW of target protein)