HISPPD1 antibody (Middle Region)

Catalog No. ABIN630976

Product Details anti-HISPPD1 Antibody

Target: HISPPD1 (PPIP5K2) (diphosphoinositol Pentakisphosphate Kinase 2 (PPIP5K2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HISPPD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HISPPD1 antibody was raised against the middle region of HISPPD1

Purification: Affinity purified

Immunogen: HISPPD1 antibody was raised using the middle region of HISPPD1 corresponding to a region with amino acids SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HISPPD1 Blocking Peptide, catalog no. 33R-8626, is also available for use as a blocking control in assays to test for specificity of this HISPPD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HISPPD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HISPPD1

Target: HISPPD1 (PPIP5K2) (diphosphoinositol Pentakisphosphate Kinase 2 (PPIP5K2))

Alternative Name: HISPPD1 (PPIP5K2 Products)

Synonyms: HISPPD1 antibody, IP7K2 antibody, VIP2 antibody, AW555814 antibody, D330021B20 antibody, Hisppd1 antibody, Vip2 antibody, mKIAA0433 antibody, hisppd1 antibody, ip7k2 antibody, vip2 antibody, diphosphoinositol pentakisphosphate kinase 2 antibody, diphosphoinositol pentakisphosphate kinase 2 L homeolog antibody, PPIP5K2 antibody, Ppip5k2 antibody, ppip5k2.L antibody

Background: Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC 2.7.4.21) and PP-IP5 (also called IP7) kinase (EC 2.7.4.24) activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively.

Molecular Weight: 138 kDa (MW of target protein)

Pathways: Inositol Metabolic Process