CDT2/RAMP antibody

Catalog No. ABIN630978

Product Details anti-CDT2/RAMP Antibody

Target: CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDT2/RAMP antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DTL antibody was raised using a synthetic peptide corresponding to a region with amino acids VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DTL Blocking Peptide, catalog no. 33R-9712, is also available for use as a blocking control in assays to test for specificity of this DTL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDT2/RAMP

Target: CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))

Alternative Name: DTL (DTL Products)

Synonyms: CDT2 antibody, DCAF2 antibody, L2DTL antibody, RAMP antibody, 2810047L02Rik antibody, 5730564G15Rik antibody, Ramp antibody, RGD1310439 antibody, cdt2 antibody, cdt2-a antibody, dcaf2 antibody, l2dtl antibody, ramp antibody, cb151 antibody, chunp6871 antibody, wu:fb54b02 antibody, denticleless E3 ubiquitin protein ligase homolog antibody, denticleless E3 ubiquitin protein ligase antibody, denticleless E3 ubiquitin protein ligase homolog S homeolog antibody, denticleless E3 ubiquitin protein ligase homolog (Drosophila) antibody, DTL antibody, Dtl antibody, dtl.S antibody, dtl antibody

Background: DTL is required for CDT1 proteolysis in response to DNA damage through the CUL4-DDB1 E3 ubiquitin-protein ligase. It seems to be necessary to ensure proper cell cycle regulation of DNA replication. DTL may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. It also may play a role in cell proliferation of NT2 embryonal carcinoma cells.

Molecular Weight: 79 kDa (MW of target protein)