MRPS2 antibody (N-Term)
-
- Target See all MRPS2 Antibodies
- MRPS2 (Mitochondrial Ribosomal Protein S2 (MRPS2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MRPS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MRPS2 antibody was raised against the N terminal of MRPS2
- Purification
- Affinity purified
- Immunogen
- MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR
- Top Product
- Discover our top product MRPS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MRPS2 Blocking Peptide, catalog no. 33R-5791, is also available for use as a blocking control in assays to test for specificity of this MRPS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPS2 (Mitochondrial Ribosomal Protein S2 (MRPS2))
- Alternative Name
- MRPS2 (MRPS2 Products)
- Synonyms
- MRP-S2 antibody, S2mt antibody, 1500019M10Rik antibody, mitochondrial ribosomal protein S2 antibody, Mrps2 antibody, MRPS2 antibody
- Background
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-