GRPEL2 antibody

Catalog No. ABIN630999

Product Details anti-GRPEL2 Antibody

Target: GRPEL2 (GrpE-Like 2, Mitochondrial (GRPEL2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRPEL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GRPEL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRPEL2 Blocking Peptide, catalog no. 33R-3717, is also available for use as a blocking control in assays to test for specificity of this GRPEL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRPEL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRPEL2

Target: GRPEL2 (GrpE-Like 2, Mitochondrial (GRPEL2))

Alternative Name: GRPEL2 (GRPEL2 Products)

Synonyms: mt-GrpE2 antibody, mt-Grpel2 antibody, Afap1l1 antibody, Mt-GrpE2 antibody, GrpE-like 2, mitochondrial antibody, GrpE like 2, mitochondrial antibody, Grpel2 antibody, GRPEL2 antibody

Background: GRPEL2 is an essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL2 seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. GRPEL2 stimulates ATPase activity of mt-HSP70. GRPEL2 may also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.

Molecular Weight: 25 kDa (MW of target protein)