MRPL48 antibody (Middle Region)

Catalog No. ABIN631007

Product Details anti-MRPL48 Antibody

Target: MRPL48 (Mitochondrial Ribosomal Protein L48 (MRPL48))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL48 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPL48 antibody was raised against the middle region of MRPL48

Purification: Affinity purified

Immunogen: MRPL48 antibody was raised using the middle region of MRPL48 corresponding to a region with amino acids KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL48 Blocking Peptide, catalog no. 33R-4469, is also available for use as a blocking control in assays to test for specificity of this MRPL48 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL48

Target: MRPL48 (Mitochondrial Ribosomal Protein L48 (MRPL48))

Alternative Name: MRPL48 (MRPL48 Products)

Synonyms: HSPC290 antibody, L48MT antibody, MRP-L48 antibody, 1810030E20Rik antibody, 2610028L11Rik antibody, CGI-118 antibody, D4Ertd786e antibody, mitochondrial ribosomal protein L48 antibody, MRPL48 antibody, Mrpl48 antibody

Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Molecular Weight: 24 kDa (MW of target protein)