TCL1A antibody (N-Term)

Catalog No. ABIN631022

Product Details anti-TCL1A Antibody

Target: TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCL1A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TCL1 A antibody was raised against the N terminal of TCL1

Purification: Affinity purified

Immunogen: TCL1 A antibody was raised using the N terminal of TCL1 corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCL1A Blocking Peptide, catalog no. 33R-5631, is also available for use as a blocking control in assays to test for specificity of this TCL1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCL1A

Target: TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))

Alternative Name: TCL1A (TCL1A Products)

Synonyms: TCL1A antibody, Tcl1a antibody, TCL1 antibody, Tcl1 antibody, T-cell leukemia/lymphoma 1A antibody, T cell lymphoma breakpoint 1 antibody, TCL1A antibody, Tcl1 antibody, Tcl1a antibody

Background: TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3, promote nuclear translocation of AKT1, enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.

Molecular Weight: 13 kDa (MW of target protein)

Pathways: Stem Cell Maintenance