IDH1 antibody

Catalog No. ABIN631025

Product Details anti-IDH1 Antibody

Target: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IDH1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IDH1 Blocking Peptide, catalog no. 33R-6238, is also available for use as a blocking control in assays to test for specificity of this IDH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IDH1

Target: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Alternative Name: IDH1 (IDH1 Products)

Synonyms: IDCD antibody, IDH antibody, IDP antibody, IDPC antibody, PICD antibody, NADP-CICDH antibody, AI314845 antibody, AI788952 antibody, E030024J03Rik antibody, Id-1 antibody, Idh-1 antibody, Idpc antibody, cb876 antibody, fm90e09 antibody, im:7143416 antibody, wu:fm90e09 antibody, F23E12.180 antibody, F23E12_180 antibody, IDH-I antibody, NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1 antibody, isocitrate dehydrogenase 1 antibody, isocitrate dehydrogenase I antibody, isocitrate dehydrogenase (NADP(+)) 1, cytosolic antibody, isocitrate dehydrogenase 1 (NADP+), soluble antibody, isocitrate dehydrogenase 1 (NADP+) L homeolog antibody, isocitrate dehydrogenase 1 antibody, IDH1 antibody, Idh1 antibody, idh1.L antibody, idh1 antibody

Background: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Warburg Effect