Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial (N-Term) antibody

Catalog No. ABIN631056

Product Details

Target: Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: ACADM antibody was raised against the N terminal of ACADM

Purification: Affinity purified

Immunogen: ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACADM Blocking Peptide, catalog no. 33R-1020, is also available for use as a blocking control in assays to test for specificity of this ACADM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial

Alternative Name: ACADM

Synonyms: ACAD1 antibody, MCAD antibody, MCADH antibody, AU018656 antibody, acyl-CoA dehydrogenase medium chain antibody, acyl-Coenzyme A dehydrogenase, medium chain antibody, acyl-CoA dehydrogenase, C-4 to C-12 straight chain antibody, ACADM antibody, Acadm antibody

Background: ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.

Molecular Weight: 46 kDa (MW of target protein)