FBXO31 antibody (Middle Region)

Catalog No. ABIN631073

Product Details anti-FBXO31 Antibody

Target: FBXO31 (F-Box Protein 31 (FBXO31))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO31 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO31 antibody was raised against the middle region of FBXO31

Purification: Affinity purified

Immunogen: FBXO31 antibody was raised using the middle region of FBXO31 corresponding to a region with amino acids VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO31 Blocking Peptide, catalog no. 33R-9406, is also available for use as a blocking control in assays to test for specificity of this FBXO31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO31

Target: FBXO31 (F-Box Protein 31 (FBXO31))

Alternative Name: FBXO31 (FBXO31 Products)

Synonyms: 1110003O08Rik antibody, 2310046N15Rik antibody, Fbx14 antibody, Fbxo14 antibody, FBX14 antibody, FBXO14 antibody, Fbx31 antibody, pp2386 antibody, RGD1561069 antibody, fbx14 antibody, fbx31 antibody, fbxo14 antibody, fbxo31 antibody, F-box protein 31 antibody, F-box protein 31 S homeolog antibody, F-box protein 31 L homeolog antibody, Fbxo31 antibody, FBXO31 antibody, fbxo31 antibody, fbxo31.S antibody, fbxo31.L antibody

Background: FBXO31 is the component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in G1 arrest following DNA damage. FBXO31 specifically recognises phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, resulting in G1 arrest.

Molecular Weight: 40 kDa (MW of target protein)