ETFA antibody
-
- Target See all ETFA Antibodies
- ETFA (Electron-Transfer-Flavoprotein, alpha Polypeptide (ETFA))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ETFA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ETFA antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG
- Top Product
- Discover our top product ETFA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ETFA Blocking Peptide, catalog no. 33R-9895, is also available for use as a blocking control in assays to test for specificity of this ETFA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETFA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ETFA (Electron-Transfer-Flavoprotein, alpha Polypeptide (ETFA))
- Alternative Name
- ETFA (ETFA Products)
- Synonyms
- 2010200I21Rik antibody, D9Ertd394e antibody, ETF antibody, EMA antibody, GA2 antibody, MADD antibody, cb1020 antibody, fd06h11 antibody, wu:fd06h11 antibody, ema antibody, ga2 antibody, madd antibody, electron transfer flavoprotein alpha subunit antibody, electron-transfer-flavoprotein, alpha polypeptide antibody, putative electron-transfer-flavoprotein,alpha polypeptide antibody, electron transfer flavoprotein subunit alpha, mitochondrial antibody, electron transferring flavoprotein, alpha polypeptide antibody, electron transfer flavoprotein alpha subunit L homeolog antibody, ETFA antibody, Tc00.1047053503559.109 antibody, Tc00.1047053511693.90 antibody, LMJF_28_1140 antibody, LOC100194695 antibody, etfa antibody, Etfa antibody, etfa.L antibody
- Background
- ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-