GATM antibody
-
- Target See all GATM Antibodies
- GATM (Glycine Amidinotransferase (L-Arginine:glycine Amidinotransferase) (GATM))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GATM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GATM antibody was raised using a synthetic peptide corresponding to a region with amino acids PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN
- Top Product
- Discover our top product GATM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GATM Blocking Peptide, catalog no. 33R-6995, is also available for use as a blocking control in assays to test for specificity of this GATM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GATM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GATM (Glycine Amidinotransferase (L-Arginine:glycine Amidinotransferase) (GATM))
- Alternative Name
- GATM (GATM Products)
- Synonyms
- AT antibody, AGAT antibody, CCDS3 antibody, 1810003P21Rik antibody, AI314789 antibody, cb409 antibody, wu:fa08a06 antibody, zgc:65855 antibody, glycine amidinotransferase (L-arginine:glycine amidinotransferase) L homeolog antibody, glycine amidinotransferase antibody, glycine amidinotransferase (L-arginine:glycine amidinotransferase) antibody, gatm.L antibody, GATM antibody, Gatm antibody, gatm antibody
- Background
- GATM is a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.
- Molecular Weight
- 44 kDa (MW of target protein)
-