Cytochrome C1 antibody (Middle Region)

Catalog No. ABIN631089

Product Details anti-Cytochrome C1 Antibody

Target: Cytochrome C1 (CYC1)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cytochrome C1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYC1 antibody was raised against the middle region of CYC1

Purification: Affinity purified

Immunogen: CYC1 antibody was raised using the middle region of CYC1 corresponding to a region with amino acids RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYC1 Blocking Peptide, catalog no. 33R-8262, is also available for use as a blocking control in assays to test for specificity of this CYC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cytochrome C1

Target: Cytochrome C1 (CYC1)

Alternative Name: CYC1 (CYC1 Products)

Synonyms: DDBDRAFT_0184465 antibody, DDBDRAFT_0238603 antibody, DDB_0184465 antibody, DDB_0238603 antibody, UQCR4 antibody, 2610002H19Rik antibody, AA408921 antibody, fb80h03 antibody, im:6911272 antibody, sr:nyz104 antibody, wu:fb80h03 antibody, zgc:123089 antibody, cytochrome c1 antibody, cytochrome c-1 antibody, cytochrome c-1 L homeolog antibody, Sputw3181_0667 antibody, Shal_3628 antibody, Mpop_2472 antibody, Hneap_1140 antibody, cyc1 antibody, Bresu_2679 antibody, Fbal_3419 antibody, Sulku_2312 antibody, LOC100127128 antibody, ZMO0958 antibody, Rsph17029_0061 antibody, Mesop_2273 antibody, CYC1 antibody, Cyc1 antibody, cyc1.L antibody

Background: CYC1 is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.

Molecular Weight: 35 kDa (MW of target protein)