KLC3 antibody (Middle Region)

Catalog No. ABIN631090

Product Details anti-KLC3 Antibody

Target: KLC3 (Kinesin Light Chain 3 (KLC3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KLC3 antibody was raised against the middle region of KLC3

Purification: Affinity purified

Immunogen: KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLC3 Blocking Peptide, catalog no. 33R-6199, is also available for use as a blocking control in assays to test for specificity of this KLC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLC3

Target: KLC3 (Kinesin Light Chain 3 (KLC3))

Alternative Name: KLC3 (KLC3 Products)

Synonyms: wu:fk22d07 antibody, zgc:153164 antibody, KLC2 antibody, KLC2L antibody, KLCt antibody, KNS2B antibody, BC017147 antibody, Klct antibody, kinesin light chain 3 antibody, KLC3 antibody, klc3 antibody, PTRG_03762 antibody, PTRG_11380 antibody, PTRG_11942 antibody, Klc3 antibody

Background: KLC3 is a member of the kinesin light chain gene family. Kinesins are molecular motors involved in the transport of cargo along microtubules, and are composed of two kinesin heavy chain (KHC) and two kinesin light chain (KLC) molecules. KLCs are thought to typically be involved in binding cargo and regulating kinesin activity. In the rat, a protein similar to this gene product is expressed in post-meiotic spermatids, where it associates with structural components of sperm tails and mitochondria.

Molecular Weight: 55 kDa (MW of target protein)