ACADL antibody (N-Term)

Catalog No. ABIN631116

Product Details anti-ACADL Antibody

Target: ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACADL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACADL antibody was raised against the N terminal of ACADL

Purification: Affinity purified

Immunogen: ACADL antibody was raised using the N terminal of ACADL corresponding to a region with amino acids MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACADL Blocking Peptide, catalog no. 33R-5609, is also available for use as a blocking control in assays to test for specificity of this ACADL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACADL

Target: ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))

Alternative Name: ACADL (ACADL Products)

Synonyms: zgc:55656 antibody, ACAD4 antibody, LCAD antibody, ACOADA antibody, AA960361 antibody, AU018452 antibody, C79855 antibody, acyl-CoA dehydrogenase long chain antibody, acyl-CoA dehydrogenase, long chain antibody, acyl-CoA dehydrogenase, long chain L homeolog antibody, acyl-Coenzyme A dehydrogenase, long-chain antibody, acadl antibody, ACADL antibody, Acadl antibody, acadl.L antibody

Background: ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in ACADL gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process