TAF7L antibody
-
- Target See all TAF7L Antibodies
- TAF7L (TAF7-Like RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 50kDa (TAF7L))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TAF7L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TAF7 L antibody was raised using a synthetic peptide corresponding to a region with amino acids QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ
- Top Product
- Discover our top product TAF7L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TAF7L Blocking Peptide, catalog no. 33R-7610, is also available for use as a blocking control in assays to test for specificity of this TAF7L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TAF7L (TAF7-Like RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 50kDa (TAF7L))
- Alternative Name
- TAF7L (TAF7L Products)
- Synonyms
- 4933438I11Rik antibody, 50kDa antibody, Taf2q antibody, RGD1564898 antibody, CT40 antibody, TAF2Q antibody, TATA-box binding protein associated factor 7 like antibody, TATA-box binding protein associated factor 7-like antibody, Taf7l antibody, TAF7L antibody
- Background
- TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.
- Molecular Weight
- 51 kDa (MW of target protein)
-