Diazepam Binding Inhibitor antibody

Catalog No. ABIN631130

Product Details anti-Diazepam Binding Inhibitor Antibody

Target: Diazepam Binding Inhibitor (DBI)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Diazepam Binding Inhibitor antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DBI antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DBI Blocking Peptide, catalog no. 33R-6477, is also available for use as a blocking control in assays to test for specificity of this DBI antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Diazepam Binding Inhibitor

Target: Diazepam Binding Inhibitor (DBI)

Alternative Name: DBI (DBI Products)

Synonyms: ACBD1 antibody, ACBP antibody, CCK-RP antibody, EP antibody, dbib antibody, DBI antibody, wu:fb63e10 antibody, zgc:56108 antibody, zgc:77734 antibody, Acbp antibody, endozepine antibody, Acoabp3 antibody, Ep antibody, Odn antibody, RNACOABP3 antibody, Ttn antibody, acbd1 antibody, acbp antibody, cck-rp antibody, dbi antibody, dbi-a antibody, dbi-b antibody, dbia antibody, diazepam binding inhibitor, acyl-CoA binding protein antibody, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) S homeolog antibody, diazepam-binding inhibitor antibody, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) antibody, acyl-CoA-binding protein antibody, diazepam binding inhibitor antibody, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) L homeolog antibody, DBI antibody, dbi.S antibody, dbi antibody, LOC706367 antibody, Dbi antibody, dbi.L antibody

Background: DBI is diazepam binding inhibitor. The protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. DBI is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis.

Molecular Weight: 10 kDa (MW of target protein)