SNRK antibody (Middle Region)

Catalog No. ABIN631138

Product Details anti-SNRK Antibody

Target: SNRK (SNF Related Kinase (SNRK))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SNRK antibody was raised against the middle region of SNRK

Purification: Affinity purified

Immunogen: SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRK Blocking Peptide, catalog no. 33R-8848, is also available for use as a blocking control in assays to test for specificity of this SNRK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRK

Target: SNRK (SNF Related Kinase (SNRK))

Alternative Name: SNRK (SNRK Products)

Synonyms: HSNFRK antibody, 2010012F07Rik antibody, AI448042 antibody, AW547029 antibody, E030034B15 antibody, R74830 antibody, mKIAA0096 antibody, SNF related kinase antibody, SNRK antibody, Snrk antibody

Background: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Molecular Weight: 84 kDa (MW of target protein)