UBE3B antibody (Middle Region)

Catalog No. ABIN631147

Product Details anti-UBE3B Antibody

Target: UBE3B (Ubiquitin Protein Ligase E3B (UBE3B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE3B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UBE3 B antibody was raised against the middle region of UBE3

Purification: Affinity purified

Immunogen: UBE3 B antibody was raised using the middle region of UBE3 corresponding to a region with amino acids VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE3B Blocking Peptide, catalog no. 33R-9458, is also available for use as a blocking control in assays to test for specificity of this UBE3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE3B

Target: UBE3B (Ubiquitin Protein Ligase E3B (UBE3B))

Alternative Name: UBE3B (UBE3B Products)

Synonyms: si:dkey-189p24.3 antibody, BPIDS antibody, AI449831 antibody, AU020130 antibody, ubiquitin protein ligase E3B antibody, ubiquitin-protein ligase E3B antibody, ubiquitin protein ligase E3B L homeolog antibody, UBE3B antibody, ube3b antibody, LOC581811 antibody, ube3b.L antibody, Ube3b antibody

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.

Molecular Weight: 123 kDa (MW of target protein)