DNAJB6 antibody

Catalog No. ABIN631148

Product Details anti-DNAJB6 Antibody

Target: DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6 (DNAJB6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJB6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DNAJB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJB6 Blocking Peptide, catalog no. 33R-7052, is also available for use as a blocking control in assays to test for specificity of this DNAJB6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJB6

Target: DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6 (DNAJB6))

Alternative Name: DNAJB6 (DNAJB6 Products)

Synonyms: DJ4 antibody, DnaJ antibody, HHDJ1 antibody, HSJ-2 antibody, HSJ2 antibody, LGMD1E antibody, MRJ antibody, MSJ-1 antibody, Mrj antibody, mDj4 antibody, dnajb6 antibody, zgc:56709 antibody, hsj2 antibody, DnaJ heat shock protein family (Hsp40) member B6 antibody, DnaJ (Hsp40) homolog, subfamily B, member 6b antibody, DnaJ heat shock protein family (Hsp40) member B6 S homeolog antibody, DnaJ heat shock protein family (Hsp40) member B6 L homeolog antibody, DNAJB6 antibody, Dnajb6 antibody, dnajb6b antibody, dnajb6.S antibody, dnajb6.L antibody

Background: DNAJB6 is a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons.

Molecular Weight: 36 kDa (MW of target protein)